PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_018789-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 284aa    MW: 32127.3 Da    PI: 8.6597
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_018789-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.3e-16956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll ++++++G g W +++ + g++R++k+c++rw++yl
    NNU_018789-RA  9 KGAWTEEEDMLLRKCIERYGEGKWCKVPLRAGLNRCRKSCRLRWLNYL 56
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.487160IPR017930Myb domain
SuperFamilySSF466897.42E-20683IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-21764IPR009057Homeodomain-like
SMARTSM007175.6E-15858IPR001005SANT/Myb domain
PfamPF002492.7E-15956IPR001005SANT/Myb domain
CDDcd001672.90E-111156No hitNo description
PROSITE profilePS500904.2865988IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.3E-66588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MDGGLGLRKG AWTEEEDMLL RKCIERYGEG KWCKVPLRAG LNRCRKSCRL RWLNYLRPGI  60
KRGEWSLIAG RLPGRTANGI KNYCKTRLSK NKLAPKKEEK AKYSTVEKFK AIRPQPRTLS  120
KSSRWFRPLA DNSTSEGVTS QSGGEILSKA ASDNSTTVGT NNRSGEMPNE TTPDLPPPTD  180
DLMQWWKSVL DESDHMDTTC PIIRGSERCG PSVQVQPTIE GGNPYQWDNF DKTDEWDDLS  240
FSEKVWDLLA SEMNQISGEQ AINAAINARE DMNKTWKHVE MSPI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274761.10.0PREDICTED: myb-related protein 330-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.16e-44myb domain protein 113